Description

  • Product name

    Recombinant Human Robo1 protein
    See all Robo1 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYI EVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      491 to 589

Specifications

Our Abpromise guarantee covers the use of ab114299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Deleted in U twenty twenty
    • DUTT 1
    • DUTT1
    • FLJ21882
    • H Robo 1
    • H-Robo-1
    • hRobo 1
    • Robo 1
    • Robo1
    • ROBO1_HUMAN
    • Roundabout 1
    • Roundabout axon guidance receptor homolog 1
    • Roundabout homolog 1
    • Roundabout homolog1 precurser
    • Roundabout1
    • SAX 3
    • SAX3
    see all
  • Function

    Receptor for SLIT1 and SLIT2 which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development. In axon growth cones, the silencing of the attractive effect of NTN1 by SLIT2 may require the formation of a ROBO1-DCC complex. May be required for lung development.
  • Tissue specificity

    Widely expressed, with exception of kidney.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. ROBO family.
    Contains 3 fibronectin type-III domains.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Ubiquitinated. May be deubiquitinated by USP33.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE image showing ab114299 Stained with Coomassie Blue.

References

ab114299 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up