Description

  • Product name

    Recombinant Human Robo4 protein
  • Purity

    > 95 % SDS-PAGE.
    ab174019 was lyophilized from 0.22 µm filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QDSPPQILVHPQDQLFQGPGPARMSCQASGQPPPTIRWLLNGQPLSMVPP DPHHLLPDGTLLLLQPPARGHAHDGQALSTDLGVYTCEASNRLGTAVSRG ARLSVAVLREDFQIQPRDMVAVVGEQFTLECGPPWGHPEPTVSWWKDGKP LALQPGRHTVSGGSLLMARAEKSDEGTYMCVATNSAGHRESRAARVSIQE PQDYTEPVELLAVRIQLENVTLLNPDPAEGPKP RPAVWLSWKVSGPAAPAQSYTALFRTQTAPGGQGAPWAEELLAGWQSAEL GGLHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEKVPSAPPQEVTLKPGN GTVFVSWVPPPAENHNGIIR GYQVWSLGNT SLPPANWTVV GEQTQLEIAT HMPGSYCVQV AAVTGAGAGE PSRPVCLLLE QAMERATQEP SEHGPWTLEQ LRATLKRPE
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      28 to 469
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C long term. Avoid freeze / thaw cycle.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • ECSM4
    • FLJ20798
    • Magic roundabout
    • MGC133352
    • MGC133353
    • MRB
    • Robo 4
    • ROBO4
    • ROBO4_HUMAN
    • Roundabout homolog 4
    • Roundabout homolog 4 magic roundabout
    • Roundabout homolog 4 Precursor
    • Roundabout, axon guidance receptor, homolog 4 (Drosophila)
    see all
  • Information by UniProt

Images

  • Reduced SDS-PAGE analysis of ab174019, stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 55-67 kDa due to glycosylation.

References

ab174019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up