Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLL LLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRP SRQLAPNKPS
    • Amino acids
      1279 to 1388
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • coiled-coil-containing protein kinase 2
    • KIAA0619
    • p164 ROCK 2
    • p164 ROCK-2
    • Rho associated coiled coil containing protein kinase 2
    • Rho associated protein kinase 2
    • Rho associated, coiled coil containing protein kinase II
    • Rho kinase 2
    • Rho-associated
    • Rho-associated protein kinase 2
    • ROCK 2
    • Rock II
    • Rock2
    • ROCK2_HUMAN
    • Rock2m
    • ROK alpha
    • ROKalpha
    see all
  • Function
    Regulates the assembly of the actin cytoskeleton. Promotes formation of stress fibers and of focal adhesion complexes. Plays a role in smooth muscle contraction.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 PH domain.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 protein kinase domain.
    Contains 1 REM (Hr1) repeat.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Cell membrane. Cytoplasmic, and associated with actin microfilaments and the plasma membrane.
  • Information by UniProt

Images

  • ab160505 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:
  • Bai H  et al. Association of moderate aerobic exercise and rho-associated kinase 2 concentration in subjects with dyslipidemia. Arch Med Sci 13:807-812 (2017). Read more (PubMed: 28721148) »
  • Liao HC  et al. Effects and mechanism of moderate aerobic exercise on impaired fasting glucose improvement. Lipids Health Dis 14:157 (2015). Human . Read more (PubMed: 26630989) »

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up