Description

  • Product name

    Recombinant Human ROR alpha/RORA protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICK VSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
    • Amino acids

      424 to 523
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as ROR alpha

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • fhl2a
    • NR1F1
    • Nuclear receptor ROR alpha
    • Nuclear receptor ROR-alpha
    • Nuclear receptor RZR-alpha
    • Nuclear receptor subfamily 1 group F member 1
    • RAR related orphan receptor A
    • RAR related orphan receptor alpha
    • RAR-related orphan receptor A
    • Retinoid-related orphan receptor-alpha
    • Rora
    • RORA_HUMAN
    • RZR alpha
    • RZR-ALPHA
    • RZRA
    • Transcription factor RZR alpha
    see all
  • Function

    Orphan nuclear receptor. Binds DNA as a monomer to hormone response elements (HRE) containing a single core motif half-site preceded by a short A-T-rich sequence. This isomer binds to the consensus sequence 5'-[AT][TA]A[AT][CGT]TAGGTCA-3'. Regulates a number of genes involved in lipid metabolism such as apolipoproteins AI, APOA5, CIII, CYP71 and PPARgamma, in cerebellum and photoreceptor development including PCP2, OPN1SW, OPN1SM AND ARR3, in circadian rhythm with BMAL1, and skeletal muscle development with MYOD1. Possible receptor for cholesterol or one of its derivatives.
  • Tissue specificity

    Widely expressed in a number of tissues.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Post-translational
    modifications

    Phosphorylation by PKC in neurons inhibits transcriptional activity. Phosphorylated on Thr-216 by ERK2 in vitro.
    Sumoylated by SENP1 and SENP2. Sumoylation, promoted by PIAS2, PIAS3, PIASy but not PIAS1, enhances the transcriptional activity. Desumoylated by SENP1.
    Ubiquitinated. Ubiquitination is required for efficient transcriptional activity and is prevented by Hairless.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab159367 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159367 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159367.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up