Description

  • Product name

    Recombinant Human ROR beta/RORB protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQR NCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKH QQRLQEQRQQQSGEAEALARVYSSSISNGLSNLNNETSGTYANGHVIDLP KSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNN GQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAY QSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCL EVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLC SLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNH LDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYKELF NPDCATGCK
    • Predicted molecular weight

      77 kDa including tags
    • Amino acids

      1 to 459

Specifications

Our Abpromise guarantee covers the use of ab114845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.

     This product was previously labelled as ROR beta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bA133M9.1
    • NR1F2
    • Nuclear receptor ROR-beta
    • Nuclear receptor RZR beta
    • Nuclear receptor RZR-beta
    • Nuclear receptor subfamily 1 group F member 2
    • OTTHUMP00000021486
    • RAR related orphan receptor B
    • RAR related orphan receptor beta
    • Retinoic acid binding receptor beta
    • Retinoid-related orphan receptor-beta
    • ROR BETA
    • Rorb
    • RORB_HUMAN
    • RZR BETA
    • RZRB
    see all
  • Function

    Orphan nuclear receptor required for normal postnatal development of rod and cone photoreceptor cells. Regulates transcription of OPN1SW in cone photoreceptor cells by binding the sequence 5'-AGGTCA-3' in the OPN1SW promoter.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab114845 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up