Overview

  • Product name

    Recombinant Human ROR1 protein (30-403aa) His tag
    See all ROR1 proteins and peptides
  • Protein length

    Protein fragment
  • Description

    Recombinant Human ROR1 protein (His tag)

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHC KVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYF QCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACA RFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCH YAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARS NPMILMRL KLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSV TK SGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCF TLDENFKSDLCDIP ACDSKDSKEKNKME
    • Molecular weight

      44 kDa including tags
    • Amino acids

      30 to 403
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab221309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • dJ537F10.1
    • Inactive tyrosine protein kinase transmembrane receptor ROR1
    • MGC99659
    • Neurotrophic tyrosine kinase
    • Neurotrophic tyrosine kinase receptor related 1
    • Neurotrophic tyrosine kinase, receptor related 1
    • NTRKR1
    • OTTHUMP00000010573
    • OTTHUMP00000010574
    • OTTMUSP00000008344
    • Receptor tyrosine kinase like orphan receptor 1
    • receptor-related 1
    • RGD1559469
    • ROR 1
    • ROR1
    • ROR1_HUMAN
    • RP11 24J23.1
    • Tyrosine kinase like orphan receptor 1
    • Tyrosine protein kinase transmembrane receptor ROR1
    • Tyrosine-protein kinase transmembrane receptor ROR1
    see all
  • Function

    Tyrosine-protein kinase receptor whose role is not yet clear.
  • Tissue specificity

    Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. ROR subfamily.
    Contains 1 FZ (frizzled) domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 kringle domain.
    Contains 1 protein kinase domain.
  • Developmental stage

    Expressed at high levels during early embryonic development. The expression levels drop strongly around day 16 and there are only very low levels in adult tissues.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab221309 stained overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 55-66 kDa in SDS-PAGE due to glycosylation.

References

ab221309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up