Description

  • Product name

    Recombinant Human ROR1 protein (39-151aa) His tag
    See all ROR1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPT IRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKE VVSSTGVLFVKFG
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      39 to 151
    • Tags

      His tag C-Terminus
  • Description

    Recombinant Human ROR1 protein (His tag)

Specifications

Our Abpromise guarantee covers the use of ab221307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C..

    pH: 7.40
    Constituents: 5% Trehalose, 95% PBS

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • dJ537F10.1
    • Inactive tyrosine protein kinase transmembrane receptor ROR1
    • MGC99659
    • Neurotrophic tyrosine kinase
    • Neurotrophic tyrosine kinase receptor related 1
    • Neurotrophic tyrosine kinase, receptor related 1
    • NTRKR1
    • OTTHUMP00000010573
    • OTTHUMP00000010574
    • OTTMUSP00000008344
    • Receptor tyrosine kinase like orphan receptor 1
    • receptor-related 1
    • RGD1559469
    • ROR 1
    • ROR1
    • ROR1_HUMAN
    • RP11 24J23.1
    • Tyrosine kinase like orphan receptor 1
    • Tyrosine protein kinase transmembrane receptor ROR1
    • Tyrosine-protein kinase transmembrane receptor ROR1
    see all
  • Function

    Tyrosine-protein kinase receptor whose role is not yet clear.
  • Tissue specificity

    Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. ROR subfamily.
    Contains 1 FZ (frizzled) domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 kringle domain.
    Contains 1 protein kinase domain.
  • Developmental stage

    Expressed at high levels during early embryonic development. The expression levels drop strongly around day 16 and there are only very low levels in adult tissues.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab221307 under reducing conditions and staining overnight with Coomassie Blue. 

    The reducing protein migrates as 30 kDa due to glycosylation.

References

ab221307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up