Description

  • Product name

    Recombinant Human ROR1 protein
    See all ROR1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab203533 was refolded using temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGEFQETELSVSAELVPTSSWNISSE LNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQE PRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFG PPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQ ITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDE CEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGI PMADPINKNHKCYNSTGVDY RGTVSVTKSGRQCQPWNSQYPHTHTFTA LRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEK NKMEILY
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      30 to 406
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. NP_005003.

Specifications

Our Abpromise guarantee covers the use of ab203533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose, DTT

General Info

  • Alternative names

    • dJ537F10.1
    • Inactive tyrosine protein kinase transmembrane receptor ROR1
    • MGC99659
    • Neurotrophic tyrosine kinase
    • Neurotrophic tyrosine kinase receptor related 1
    • Neurotrophic tyrosine kinase, receptor related 1
    • NTRKR1
    • OTTHUMP00000010573
    • OTTHUMP00000010574
    • OTTMUSP00000008344
    • Receptor tyrosine kinase like orphan receptor 1
    • receptor-related 1
    • RGD1559469
    • ROR 1
    • ROR1
    • ROR1_HUMAN
    • RP11 24J23.1
    • Tyrosine kinase like orphan receptor 1
    • Tyrosine protein kinase transmembrane receptor ROR1
    • Tyrosine-protein kinase transmembrane receptor ROR1
    see all
  • Function

    Tyrosine-protein kinase receptor whose role is not yet clear.
  • Tissue specificity

    Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. ROR subfamily.
    Contains 1 FZ (frizzled) domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 kringle domain.
    Contains 1 protein kinase domain.
  • Developmental stage

    Expressed at high levels during early embryonic development. The expression levels drop strongly around day 16 and there are only very low levels in adult tissues.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab203533 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up