Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHC KVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYY QCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGIACA RFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCH FVFPLCDARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQL PKCEALPMPESPDAANCMRIGIPAERLGRYHQCYNGSGMDYRGTASTTKS GHQCQPWALQHPHSHHLSSTDFPELGGGHAYCRNPGGQMEGPWCFTQNKN VRMELCDVPSCSPRDSSKMG
    • Molecular weight

      43 kDa including tags
    • Amino acids

      34 to 403
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_004551).

Specifications

Our Abpromise guarantee covers the use of ab221029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • BDB
    • BDB1
    • Brachydactyly type B
    • EC 2.7.10.1
    • MGC163394
    • Neurotrophic tyrosine kinase
    • Neurotrophic tyrosine kinase, receptor related 2
    • NTRKR2
    • Receptor tyrosine kinase-like orphan receptor 2
    • receptor-related 2
    • ROR2
    • ROR2_HUMAN
    • Tyrosine protein kinase transmembrane receptor ROR2
    • Tyrosine-protein kinase transmembrane receptor Ror2
    see all
  • Function

    Tyrosine-protein kinase receptor which may be involved in the early formation of the chondrocytes. It seems to be required for cartilage and growth plate development. Phosphorylates YWHAB, leading to induction of osteogenesis and bone formation.
  • Involvement in disease

    Brachydactyly B1
    Robinow syndrome autosomal recessive
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. ROR subfamily.
    Contains 1 FZ (frizzled) domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 kringle domain.
    Contains 1 protein kinase domain.
  • Developmental stage

    Expressed at high levels during early embryonic development. The expression levels drop strongly around day 16 and there are only very low levels in adult tissues.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab221029 stained overnight with Coomassie Blue. The reducing protein migrates as 55 kDa in SDS-PAGE due to glycosylation.

References

ab221029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up