Description

  • Product name

    Recombinant human ROS1 protein
    See all ROS1 proteins and peptides
  • Biological activity

    8 pmol/min/μg. 

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HRRLKNQKSAKEGVTVLINEDKELAELRGLAAGVGLANACYAIHTLPTQE EIENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVKTL KKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGG DLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAA RNCLVSVKDYTSPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPES LMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEP PRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSIYKSRDE ANNSGVINESFEGEDGDVICLNSDDIMPVALMETKNREGLNYMVLATECG QGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPEGL NYACLTHSGYGDGSD
    • Predicted molecular weight

      78 kDa including tags
    • Amino acids

      1883 to 2347
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      Genbank accession: NM_002944.

Specifications

Our Abpromise guarantee covers the use of ab196092 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.4% Tris HCl, 0.58% Sodium chloride, 0.05% Tween, 20% Glycerol, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • c ros
    • c ros 1
    • c ros oncogene 1 receptor tyrosine kinase
    • c Ros receptor tyrosine kinase
    • c ros1
    • MCF 3
    • MCF3
    • Oncogene ROS
    • OTTHUMP00000017814
    • OTTHUMP00000017815
    • OTTHUMP00000040389
    • Proto oncogene c Ros
    • Proto oncogene c ros 1 protein
    • Proto oncogene tyrosine protein kinase ROS
    • Proto oncogene tyrosine protein kinase ROS precursor
    • Proto-oncogene c-Ros-1
    • Proto-oncogene tyrosine-protein kinase ROS
    • Receptor tyrosine kinase c ros oncogene 1
    • ROS
    • Ros 1
    • ROS 1C
    • ROS proto oncogene 1 , receptor tyrosine kinase
    • ROS_HUMAN
    • ROS1
    • ROS1C
    • Transmembrane tyrosine specific protein kinase
    • v ros avian UR2 sarcoma virus oncogene homolog 1
    • v ros UR2 sarcoma virus oncogene homolog 1
    see all
  • Function

    This is probably a cell growth or differentiation factor receptor with a tyrosine-protein kinase activity.
  • Tissue specificity

    Expressed in brain. Expression is increased in primary gliomas.
  • Involvement in disease

    Note=A chromosomal aberration involving ROS1 is found in a glioblastoma multiforme sample. An intra-chromosomal deletion del(6)(q21q21) is responsible for the formation of GOPC-ROS1 chimeric protein which has a constitutive receptor tyrosine kinase activity.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 9 fibronectin type-III domains.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of 6 µg ab196092 stained with Coomassie blue.

  • Functional analysis of ab196092.

     

References

ab196092 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196092.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up