Overview

  • Product name

    Recombinant Human RPC39 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAEVKVKVQPPDADPVEIENRIIELCH QFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSNTGLLYRIK DSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINKIL KNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFV EVLNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISK VELSMEDIETILNTLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPII PPTGLVRAPCGLCPVFDDCHEGGEISPSNCIYMTEWLEF
    • Molecular weight

      38 kDa including tags
    • Amino acids

      1 to 316
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139235 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab139235 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

    Previously labelled as POLR3F.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 30% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • DNA directed RNA polymerase III 39 kDa polypeptide
    • DNA directed RNA polymerase III 39 kDa polypeptide F
    • DNA directed RNA polymerase III subunit F
    • DNA directed RNA polymerase III subunit RPC6
    • DNA directed RNA polymerases III 39 kDa polypeptide
    • DNA-directed RNA polymerase III subunit F
    • DNA-directed RNA polymerase III subunit RPC6
    • MGC13517
    • Polr3f
    • Polymerase (RNA) III (DNA directed) polypeptide F
    • RNA polymerase III 39 kDa subunit
    • RNA polymerase III C39 subunit
    • RNA polymerase III subunit C6
    • RPC 39
    • RPC 6
    • RPC39
    • RPC6
    • RPC6_HUMAN
    see all
  • Function

    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. May direct RNA Pol III binding to the TFIIIB-DNA complex. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
  • Sequence similarities

    Belongs to the eukaryotic RPC34/RPC39 RNA polymerase subunit family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139235.

References

ab139235 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139235.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up