Overview

  • Product name

    Recombinant Human RPE protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFG HPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATEN PGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQ KFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAI MRSEDPRSVINLLRNVCSEAAQKRSLDRVDHHHHHH
    • Molecular weight

      26 kDa including tags
    • Amino acids

      1 to 228
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173049 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 6.20
    Constituents: 0.88% Sodium chloride, 99% Phosphate Buffer

General Info

  • Alternative names

    • 2810429B02Rik
    • 5730518J08Rik
    • EC 5.1.3.1
    • MGC124653
    • MGC2636
    • OTTHUMP00000163939
    • Ribulose 5 phosphate 3 epimerase
    • Ribulose 5 phosphate epimerase
    • Ribulose phosphate 3 epimerase
    • Ribulose-5-phosphate-3-epimerase
    • Ribulose-phosphate 3-epimerase
    • rpe
    • RPE_HUMAN
    • RPE2 1
    see all
  • Function

    Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate.
  • Sequence similarities

    Belongs to the ribulose-phosphate 3-epimerase family.
  • Information by UniProt

References

ab173049 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173049.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up