Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCG HMVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRIN KMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIE ALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYI PSRGPLDKWRALHS
    • Amino acids
      1 to 214
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 60S ribosomal protein L10
    • DKFZp686J1851
    • DXS648
    • DXS648E
    • FLJ23544
    • FLJ27072
    • L10
    • Laminin receptor homolog
    • NOV
    • OTTHUMP00000031945
    • OTTHUMP00000063212
    • OTTHUMP00000063213
    • OTTHUMP00000183506
    • OTTHUMP00000196447
    • Protein QM
    • QM
    • Ribosomal protein L10
    • Tumor suppressor QM
    • Wilms tumor related protein
    see all
  • Relevance
    Component of the large ribosomal subunit. Mature ribosomes consist of a small (40S) and a large (60S) subunit. The 40S subunit contains about 33 different proteins and 1 molecule of RNA (18S). The 60S subunit contains about 49 different proteins and 3 molecules of RNA (28S, 5.8S and 5S). Down-regulated during adipocyte, kidney, and heart differentiation. Note=Two hypomorphic variants with respect to the regulation of the translation process have been found in families affected by autism spectrum disorders, suggesting that aberrant processes of ribosome biosynthesis and translation may play a role in disease mechanisms.
  • Cellular localization
    Endoplasmic reticulum Cytosolic large ribosomal subunit

Images

  • ab159379 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:
  • Shi C  et al. Cooperative down-regulation of ribosomal protein L10 and NF-?B signaling pathway is responsible for the anti-proliferative effects by DMAPT in pancreatic cancer cells. Oncotarget 8:35009-35018 (2017). Read more (PubMed: 28388532) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up