Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLI IRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMR
    • Molecular weight

      37 kDa including tags
    • Amino acids

      1 to 100

Specifications

Our Abpromise guarantee covers the use of ab152661 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 60S ribosomal protein L19
    • DKFZp779D216
    • FLJ27452
    • HGNC:10312
    • L19
    • MGC71997
    • Ribosomal Protein L19
    • Ribosomal protein L19, cytosolic, N terminus truncated
    • RL19_HUMAN
    • rpl19
    see all
  • Sequence similarities

    Belongs to the ribosomal protein L19e family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152661 stained with Coomassie Blue.

References

ab152661 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152661.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up