Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTV HVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETIEKMQE
    • Molecular weight

      37 kDa including tags
    • Amino acids

      46 to 145

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as Ribosomal protein L26

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • RPL26L1
    • 60S ribosomal protein L26
    • 60S ribosomal protein L26 like 1
    • DBA11
    • FLJ46904
    • L26
    • OTTHUMP00000135333
    • PTB associated splicing factor
    • Ribosomal protein L26
    • Ribosomal protein L26 homolog
    • Ribosomal protein L26 like 1
    • Ribosomal protein L26 pseudogene 1
    • RL26_HUMAN
    • rpl26
    • RPL26P1
    see all
  • Sequence similarities

    Belongs to the ribosomal protein L24P family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152662 stained with Coomassie Blue.

References

ab152662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up