Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHN KKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLAYIA HPKLGKRARARIAKGLRLCRPKAKAKAKDQTKAQAAAPASVPAQAPKRTQ APTKASE
    • Molecular weight

      44 kDa including tags
    • Amino acids

      1 to 157

Specifications

Our Abpromise guarantee covers the use of ab132678 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 60S ribosomal protein L29
    • Cell surface heparin binding protein HIP
    • Cell surface heparin-binding protein HIP
    • Heparin/heparan sulfate interacting protein
    • Heparin/heparan sulfate-binding protein
    • HIP
    • HP/HS interacting protein
    • HUMRPL29
    • MGC88589
    • OTTHUMP00000212470
    • OTTHUMP00000212473
    • OTTHUMP00000212474
    • OTTHUMP00000212475
    • OTTHUMP00000212476
    • OTTHUMP00000212477
    • Ribosomal protein L29
    • ribosomal protein YL43 homologue
    • RL29_HUMAN
    • rpl29
    • RPL29_3_370
    • RPL29P10
    see all
  • Sequence similarities

    Belongs to the ribosomal protein L29e family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132678 stained with Coomassie Blue.

References

ab132678 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132678.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up