Description

  • Product name

    Recombinant Human RPL7 protein
    See all RPL7 proteins and peptides
  • Expression system

    Escherichia coli
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYR TE IRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRL RQIFNG TFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKI NKKRIALTDN ALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWP FKLSSPRGGMKKKT THFVEGGDAGNREDQINRLIRRMN (Amino acid sequence (Sequence determined by 5' Sequencing))
    • Amino acids

      17 to 248

Specifications

Our Abpromise guarantee covers the use of ab91722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Form

    Lyophilised
  • Additional notes

    Protein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 4.50
    Constituents: 0.5% Trehalose, 36% Urea, 1.64% Sodium phosphate, 0.058% Sodium chloride

  • Reconstitution
    Reconstitute with 65 µl aqua dest.

General Info

  • Alternative names

    • 60S ribosomal protein L7
    • humL7 1
    • L7
    • Ribosomal protein L7
    • RL7_HUMAN
    • RPL 7
    • RPL7
    • Rpl7a
    • Surf 3
    see all
  • Function

    Binds to G-rich structures in 28S rRNA and in mRNAs. Plays a regulatory role in the translation apparatus; inhibits cell-free translation of mRNAs.
  • Sequence similarities

    Belongs to the ribosomal protein L30P family.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab91722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

The reconstitution volume ab91722 is lot-specific.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up