Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFPREDRATWKSNYFLKIIQLLD DYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENN PALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVT VPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEA TLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNV ASVCLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFLADP SAFVAAAPVAAATTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD
    • Molecular weight

      37 kDa including tags
    • Amino acids

      2 to 317
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      With 29 aa N-terminal T7 / His / TEV cleavage site tag (NP_000993.1).

Specifications

Our Abpromise guarantee covers the use of ab205214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab205214 was expressed in E.coli as inclusion bodies, refolded using a unique “temperature shift inclusion body refolding” technology, chromatographically purified and sterile-filtered.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.

    pH: 8
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose and DTT.

General Info

  • Alternative names

    • 36B4
    • 60S acidic ribosomal protein P0
    • 60S ribosomal protein L10E
    • Acidic ribosomal phosphoprotein P0
    • Arbp
    • L10E
    • LP0
    • MGC107165
    • MGC107166
    • MGC111226
    • MGC88175
    • OTTMUSP00000015585
    • P0
    • PRLP0
    • Ribosomal phosphoprotein, acidic, P0
    • Ribosomal protein P0
    • Ribosomal protein, large, P0
    • RLA0_HUMAN
    • rplP0
    • RPP0
    see all
  • Function

    Ribosomal protein P0 is the functional equivalent of E.coli protein L10.
  • Sequence similarities

    Belongs to the ribosomal protein L10P family.
  • Cellular localization

    Nucleus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt

References

ab205214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up