Description

  • Product name

    Recombinant Human RPP20 protein
  • Purity

    > 90 % SDS-PAGE.
    ab180270 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSEFMAENREPRGAVEAELDPVEYTLRKR LPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLG LAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIR NNSAIHIRVFRVTPK
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      1 to 140
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NP_005828).

Specifications

Our Abpromise guarantee covers the use of ab180270 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 50% Glycerol, 0.03% DTT, 0.06% EDTA

General Info

  • Alternative names

    • 0610037N12Rik
    • hPOP7
    • POP7
    • POP7 (processing of precursor, S. cerevisiae) homolog
    • POP7_HUMAN
    • processing of precursor 7 ribonuclease P subunit (S. cerevisiae)
    • processing of precursor 7, S. cerevisiae, homolog of
    • Ribonuclease P protein subunit p20
    • Ribonuclease P, 20-KD subunit
    • Ribonucleases P/MRP protein subunit POP7 homolog
    • RNaseP protein p20
    • RPP2
    • RPP20
    see all
  • Function

    Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.
  • Sequence similarities

    Belongs to the histone-like Alba family.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180270 (3μg).

References

ab180270 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180270.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up