Recombinant Human RPS10 protein (ab140736)
Key features and details
- Expression system: Escherichia coli
- Purity: > 85% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Human RPS10 protein -
Purity
> 85 % SDS-PAGE.
ab140736 was purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMGSMLMPKKNRIAIYELLFKEGVMVAKKDV HMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQ YLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEADRDTY RRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQPPQ -
Predicted molecular weight
21 kDa including tags -
Amino acids
1 to 165 -
Tags
His tag N-Terminus
-
Associated products
-
Positive Controls
Specifications
Our Abpromise guarantee covers the use of ab140736 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Additional notes
This product was previously labelled as Ribosomal protein S10
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.02% DTT, 0.32% Tris HCl, 30% Glycerol (glycerin, glycerine), 0.88% Sodium chloride
General Info
-
Alternative names
- 40S ribosomal protein S10
- DBA9
- MGC88819
see all -
Function
Component of the 40S ribosomal subunit. -
Involvement in disease
Defects in RPS10 are the cause of Diamond-Blackfan anemia type 9 (DBA9) [MIM:613308]. It is a form of Diamond-Blackfan anemia, a congenital non-regenerative hypoplastic anemia that usually presents early in infancy. Diamond-Blackfan anemia is characterized by a moderate to severe macrocytic anemia, erythroblastopenia, and an increased risk of malignancy. 30 to 40% of Diamond-Blackfan anemia patients present with short stature and congenital anomalies, the most frequent being craniofacial (Pierre- Robin syndrome and cleft palate), thumb and urogenital anomalies. -
Sequence similarities
Belongs to the ribosomal protein S10e family. -
Post-translational
modificationsMethylated by PRMT5. Methylation is necessary for its interaction with NPS1, its localization in the granular component (GC) region of the nucleolus, for the proper assembly of ribosomes, protein synthesis and optimal cell proliferation. -
Cellular localization
Cytoplasm. Nucleus > nucleolus. Localized in the granular component (GC) region of the nucleolus. Methylation is required for its localization in the GC region. Co-localizes with NPS1 in the GC region of the nucleolus. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human RPS10 protein (ab140736)15% SDS-PAGE analysis of ab140736 (3 µg).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab140736 has not yet been referenced specifically in any publications.