Description

  • Product name

    Recombinant Human RPS14 protein
  • Purity

    > 80 % SDS-PAGE.
    ab105130 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAPRKGKEKKEEQVISLGPQVAEGENV FGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLA AQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRALARSGMKIG RIEDVTPIPSDSTRRKGGRRGRRL
    • Predicted molecular weight

      19 kDa including tags
    • Amino acids

      1 to 151
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 40% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • 40S ribosomal protein S14
    • emetine resistance
    • EMTB
    • Ribosomal protein S14
    • rps14
    • RS14_HUMAN
    • S14
    see all
  • Sequence similarities

    Belongs to the ribosomal protein S11P family.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab105130 at approximately 18.7kDa (3µg).

References

ab105130 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up