Overview

  • Product name
    Recombinant Human RPS6KC1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SCDSDAIERMYCAPEVGAITEETEACDWWSLGAVLFELLTGKTLVECHPA GINTHTTLNMPECVSEEARSLIQQLLQFNPLERLGAGVAGVEDIKSHPFF TPVDWAELMR
    • Amino acids
      957 to 1066
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162038 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 52 kDa ribosomal protein S6 kinase
    • humS6PKh1
    • KS6C1_HUMAN
    • Ribosomal protein S6 kinase 52kD polypeptide 1
    • Ribosomal protein S6 kinase 52kDa polypeptide 1
    • Ribosomal protein S6 kinase C1
    • Ribosomal protein S6 kinase delta 1
    • Ribosomal protein S6 kinase delta-1
    • Ribosomal S6 kinase like protein with two PSK domains 118 kDa protein
    • Ribosomal S6 kinase-like protein with two PSK domains 118 kDa protein
    • RPK 118
    • RPK118
    • RPS6KC1
    • RSKL1
    • S6K-delta-1
    • S6PKh1
    • SPHK1 binding protein
    • SPHK1-binding protein
    see all
  • Function
    May be involved in transmitting sphingosine-1 phosphate (SPP)-mediated signaling into the cell.
  • Tissue specificity
    Highly expressed in testis, skeletal muscle, brain, heart, placenta, kidney and liver and weakly expressed in thymus, small intestine, lung and colon.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. S6 kinase subfamily.
    Contains 1 MIT domain.
    Contains 2 protein kinase domains.
    Contains 1 PX (phox homology) domain.
  • Domain
    The first protein kinase domain appears to be a pseudokinase domain as it does not contain the classical characteristics, such as the ATP-binding motif, ATP-binding site and active site.
  • Cellular localization
    Cytoplasm. Membrane. Also found in some small dot-like or ring-shaped early endosome structures.
  • Information by UniProt

Images

  • ab162038 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162038 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162038.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up