Overview

  • Product name
    Recombinant Human RPUSD3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDGRRVLGRFWSGWRRGLGVRPVPEDAGFGTEARHQRQPRGSCQRSGPLG DQPFAGLLPKNLSREELVDALRAAVVDRKGPLVTLNKPQGLPVTGKPGEL TLFSVLPELSQSLGLREQELQVVRASGKESSGLVLLSSCPQTASRLQKYF THARRAQRPTATYCAVTDGIPAASEGKIQAALKLEHIDGVNLTVPVKAPS RKDILEGVKKTLSHFRVVATGSGCALVQLQPLTVFSSQLQVHMVLQLCPV LGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHLTPSQAAQL PLHLHLHRLLLPGTRARDTPVELLAPLPPYFSRTLQCLGLRLQ
    • Amino acids
      1 to 343
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ34707
    • RNA pseudouridylate synthase domain containing 3
    • RPUSD 3
  • Relevance
    RPUSD3 belongs to the pseudouridine synthase rluA family. Members of this family are involved in modifying bases in RNA molecules. Pseudouridine synthases are responsible for synthesis of pseudouridine from uracil.
  • Cellular localization
    Nuclear

Images

  • ab166200 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up