Description

  • Product name

    Recombinant Human RRM1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLL KDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVL KMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTR PAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
    • Amino acids

      593 to 792
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152668 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • R1
    • Ribonucleoside diphosphate reductase large subunit
    • Ribonucleoside diphosphate reductase M1 chain
    • Ribonucleoside diphosphate reductase subunit M1
    • Ribonucleoside reductase, large subunit
    • Ribonucleoside-diphosphate reductase large subunit
    • Ribonucleoside-diphosphate reductase subunit M1
    • Ribonucleotide reductase large chain
    • Ribonucleotide reductase large subunit
    • Ribonucleotide reductase M1
    • Ribonucleotide reductase M1 polypeptide
    • Ribonucleotide reductase R1 subunit
    • Ribonucleotide reductase, M1 subunit
    • RIR 1
    • RIR1
    • RIR1_HUMAN
    • RR 1
    • RR1
    • RRM 1
    • RRM1
    see all
  • Function

    Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.
  • Pathway

    Genetic information processing; DNA replication.
  • Sequence similarities

    Belongs to the ribonucleoside diphosphate reductase large chain family.
    Contains 1 ATP-cone domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab152668 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152668 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152668.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up