Overview

  • Product name

    Recombinant Human RRP1 like protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MVSRVQLPPEIQLAQRLAGNEQVTRDRAVRKLRKYIVARTQRAAGGFTHD ELLKVWKGLFYCMWMQDKPLLQEELGRTISQLVHAFQTTEAQHLFLQAFW QTMNREWTGIDRLRLDKFYMLMRMVLNESLKVLKMQGWEERQIEELLELL MTEILHPSSQAPNGVKSHFIEIFLEELTKVGAEELTADQNLKFIDPFCRI AARTKDSLVLNNITRGIFETIVEQAPLAIEDLLNELDTQDEEVASDSDES SEGGERGDALSQKRSEKPPAGSICRAEPEAGEEQAGDDRDSGGPVLQFDY EAVANRLFEMASRQSTPSQNRKRLYKVIRKLQDLAGGIFPEDEIPEKACR RLLEGRRQKKTKKQKRLLRLQQERGKGEKEPPSPGMERKRSRRRGVGADP EARAEAGEQPGTAERALLRDQPRGRGQRGARQRRRTPRPLTSARAKAANV QEPEKKKKRRE
    • Amino acids

      1 to 461
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • D21S2056E
    • NNP 1
    • NNP-1
    • NNP1
    • Nnp1 homolog nucleolar protein
    • NOP52
    • Novel nuclear protein 1
    • Nucleolar protein Nop52
    • Nucleolar protein, 52-KD
    • Protein NNP 1
    • Protein NNP1
    • Ribosomal RNA processing 1
    • Ribosomal RNA processing 1 homolog
    • Ribosomal RNA processing 1 homolog (S. cerevisiae)
    • Ribosomal RNA processing protein 1 homolog A
    • Ribosomal RNA processing protein 1, S. cerevisiae, homolog of
    • rrp1
    • RRP1 like protein
    • RRP1-like protein
    • RRP1_HUMAN
    • RRP1A
    see all
  • Function

    Plays a critical role in the generation of 28S rRNA.
  • Tissue specificity

    Ubiquitously expressed in fetal and adult tissues.
  • Sequence similarities

    Belongs to the RRP1 family.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab160102 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160102 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160102.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up