Description

  • Product name

    Recombinant Human RRP2 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGT YLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWITLDTGILESPFI YSPEKREEAWRFISYMLVHAG
    • Predicted molecular weight

      34 kDa
    • Amino acids

      12 to 132
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab236185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Additional notes

    Previously labelled as RHBDL2

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • MGC16997
    • RHBDL2
    • Rhomboid like protein 2
    • Rhomboid related protein 2
    • Rhomboid veinlet like 2 (Drosophila)
    • RRP2
    see all
  • Relevance

    RRP2, rhomboid like protein 2, is involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. There are 2 named isoforms produced by alternative splicing.
  • Cellular localization

    Membrane; Multi pass membrane protein.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab236185.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab236185 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) RRP2.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab236185 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) RRP2.

References

ab236185 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236185.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up