Overview

  • Product name
    Recombinant Human RRP9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSATAAARKRGKPASGAGAGAGAGKRRRKADSAGDRGKSKGGGKMNEEIS SDSESESLAPRKPEEEEEEELEETAQEKKLRLAKLYLEQLRQQEEEKAEA RAFEEDQVAGRLKEDVLEQRGRLQKLVAKEIQAPASADIRVLRGHQLSIT CLVVTPDDSAIFSAAKDCSIIKWSVESGRKLHVIPRAKKGAEGKPPGHSS HVLCMAISSDGKYLASGDRSKLILIWEAQSCQHLYTFTGHRDAVSGLAFR RGTHQLYSTSHDRSVKVWNVAENSYVETLFGHQDAVAALDALSRECCVTA GGRDGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALW GLSKKRPLALQREAHGLRGEPGLEQPFWISSVAALLNTDLVATGSHSSCV RLWQCGEGFRQLDLLCDIPLVGFINSLKFSSSGDFLVAGVGQEHRLGRWW RIKEARNSVCIIPLRRVPVPPAAGS
    • Amino acids
      1 to 475
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160353 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ribosomal RNA processing 9 small subunit (SSU) processome component homolog
    • RNA U3 small nucleolar interacting protein 2
    • RNU3IP2
    • RRP 9
    • RRP9
    • RRP9 homolog
    • RRP9 small subunit (SSU) processome component homolog
    • U3 55K
    • U3 small nucleolar ribonucleoprotein associated 55 kDa protein
    • U3 small nucleolar ribonucleoprotein-associated 55 kDa protein
    • U3 small nucleolar RNA interacting protein 2
    • U3 small nucleolar RNA-interacting protein 2
    • U3 snoRNP associated 55 kDa protein
    • U3 snoRNP-associated 55 kDa protein
    • U3-55K
    • U355K
    • U3IP2_HUMAN
    see all
  • Function
    Component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA.
  • Sequence similarities
    Belongs to the WD repeat RRP9 family.
    Contains 7 WD repeats.
  • Domain
    The WD domains are required for nucleolar localization and U3 small nucleolar RNAs binding.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab160353 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160353 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160353.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up