Overview

  • Product name
    Recombinant Human RSF1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQ TPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL
    • Amino acids
      1343 to 1441
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HBV pX associated protein 8
    • Hepatitis B virus x associated protein
    • HXBAP
    • p325
    • p325 subunit of RSF chromatin remodeling complex
    • remodeling and spacing factor 1
    • RSF 1
    • XAP8
    see all
  • Relevance
    RSF1 is involved in transcription repression when recruited to DNA via the DNA binding of GAL4. It is also involved in chromatin remodeling and spacing when associated with SNF2H and transcription coactivation when associated with hepatitis B virus X protein (HBX). The RSF1 gene is localized to the long arm of human chromosome 11 between q13.4 and q14.1. This region is amplified and rearranged in many tumors, indicating that it plays a role in tumorigenesis similar to that of other PHD-containing proteins.
  • Cellular localization
    Nuclear

Images

  • ab162662 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up