Overview

  • Product name

    Recombinant Human RSG1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMARPPVPGSVVVPNWHESAEGKEYLAC ILRKNRRRVFGLLERPVLLPPVSIDTASYKIFVSGKSGVGKTALVAKLAG LEVPVVHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDH MLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGSKF DQYMHTDVPERDLTAFRQAWELPLLRVKSVPGRRLADGRTLDGRAGLADV AHILNGLAEQLWHQDQVAAGLLPNPPESAPE
    • Molecular weight

      31 kDa including tags
    • Amino acids

      1 to 258
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139230 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 85 % SDS-PAGE.
    ab139230 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.50
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • C1orf89
    • Miro domain containing protein C1orf89
    • Rem/Rab Similar GTPase 1
    • REM2- and Rab-like small GTPase 1
    • RP4-733M16.4
    • Rsg1
    • RSG1_HUMAN
    see all
  • Function

    Potential effector of the planar cell polarity signaling pathway. Plays a role in targeted membrane trafficking most probably at the level of vesicle fusion with membranes. Involved in cilium biogenesis by regulating the transport of cargo proteins to the basal body and to the apical tips of cilia. More generally involved in exocytosis in secretory cells.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization

    Cytoplasm > cytoskeleton > cilium basal body.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139230.

References

ab139230 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139230.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up