Recombinant human Rsk 2 / MAPKAP Kinase 1b (mutated L608 F) protein (ab172182)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEI AITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMK VLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFL RGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENIL LDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSAD WWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLR MLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGR PEDTFYFDPEFTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQ TVGVHSIVQQLHRNSIQFTDGYEVKEDIGVGSYSVCKRCIHKATNMEFAV KIIDKSKRDPTEEIEILLRYGQHPNIITLKDVYDDGKYVYVVTELMKGGE LLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDLKPSNILYVDE SGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACD IWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSD TAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVK GAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL
    • Molecular weight
      84 kDa
    • Amino acids
      1 to 740
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172182 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity, 140 nmol/min/mg.

  • Applications

    Functional Studies

    Western blot

    SDS-PAGE

  • Purity
    > 95 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 25% Glycerol, 0.88% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.61% Tris-HCl buffer, 0.002% PMSF

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 90 kDa ribosomal protein S6 kinase 3
    • CLS
    • HU 3
    • HU2
    • HU3
    • Insulin stimulated protein kinase 1
    • Insulin-stimulated protein kinase 1
    • ISPK-1
    • ISPK1
    • KS6A3_HUMAN
    • MAP kinase activated protein kinase 1b
    • MAP kinase-activated protein kinase 1b
    • MAPK activated protein kinase 1b
    • MAPK-activated protein kinase 1b
    • MAPKAP kinase 1b
    • MAPKAPK 1b
    • MAPKAPK-1b
    • MAPKAPK1B
    • Mental retardation, X linked 19
    • MRX19
    • OTTHUMP00000023036
    • p90 RSK2
    • p90 RSK3
    • p90-RSK 3
    • p90RSK3
    • pp90RSK2
    • Ribosomal protein S6 kinase 90kDa polypeptide 3
    • Ribosomal protein S6 kinase alpha 3
    • Ribosomal protein S6 kinase alpha-3
    • Ribosomal protein s6 kinase ii alpha 2
    • Ribosomal S6 kinase 2
    • Rps6ka3
    • RSK
    • RSK-2
    • RSK2
    • S6 kinase 2
    • S6K alpha3
    • S6K-alpha-3
    see all
  • Function
    Serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.
  • Tissue specificity
    Expressed in many tissues, highest levels in skeletal muscle.
  • Involvement in disease
    Defects in RPS6KA3 are the cause of Coffin-Lowry syndrome (CLS) [MIM:303600]; an X-linked dominant disorder characterized by severe mental retardation with facial and digital dysmorphisms, and progressive skeletal deformations.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 2 protein kinase domains.
  • Post-translational
    modifications
    Autophosphorylated on Ser-386, as part of the activation process.
    Ser-227 phosphorylation promotes Ser-386 phosphorylation and leads to basal activation. Full activation by growth factors requires additional phosphorylation on Ser-369.
  • Information by UniProt

Images

  • ab172182 on SDS-PAGE.

  • Sample Kinase Activity Plot. ab172182 specific activity was determined to be 140 nmol/min/mg.

References

ab172182 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172182.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up