Description

  • Product name

    Recombinant human Rsk 2 / MAPKAP Kinase 1b (mutated Y483 C) protein
    See all Rsk 2 / MAPKAP Kinase 1b proteins and peptides
  • Biological activity

    The specific activity of ab204167 was determined to be 115 nmol/min/mg.

  • Purity

    > 95 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEI AITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMK VLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFL RGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENIL LDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSAD WWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLR MLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGR PEDTFYFDPEFTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQ TVGVHSIVQQLHRNSIQFTDGYEVKEDIGVGSYSVCKRCIHKATNMEFAV KIIDKSKRDPTEEIEILLRYGQHPNIITLKDVCDDGKYVYVVTELMKGGE LLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDLKPSNILYVDE SGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACD IWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSD TAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVK GAMAATYSALNRNQSPVLEP VGRSTLAQRRGIKKITSTAL
    • Predicted molecular weight

      112 kDa including tags
    • Amino acids

      1 to 740
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_004586.

Specifications

Our Abpromise guarantee covers the use of ab204167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.002% PMSF, 0.004% DTT, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 90 kDa ribosomal protein S6 kinase 3
    • CLS
    • HU 3
    • HU2
    • HU3
    • Insulin stimulated protein kinase 1
    • Insulin-stimulated protein kinase 1
    • ISPK-1
    • ISPK1
    • KS6A3_HUMAN
    • MAP kinase activated protein kinase 1b
    • MAP kinase-activated protein kinase 1b
    • MAPK activated protein kinase 1b
    • MAPK-activated protein kinase 1b
    • MAPKAP kinase 1b
    • MAPKAPK 1b
    • MAPKAPK-1b
    • MAPKAPK1B
    • Mental retardation, X linked 19
    • MRX19
    • OTTHUMP00000023036
    • p90 RSK2
    • p90 RSK3
    • p90-RSK 3
    • p90RSK3
    • pp90RSK2
    • Ribosomal protein S6 kinase 90kDa polypeptide 3
    • Ribosomal protein S6 kinase alpha 3
    • Ribosomal protein S6 kinase alpha-3
    • Ribosomal protein s6 kinase ii alpha 2
    • Ribosomal S6 kinase 2
    • Rps6ka3
    • RSK
    • RSK-2
    • RSK2
    • S6 kinase 2
    • S6K alpha3
    • S6K-alpha-3
    see all
  • Function

    Serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.
  • Tissue specificity

    Expressed in many tissues, highest levels in skeletal muscle.
  • Involvement in disease

    Defects in RPS6KA3 are the cause of Coffin-Lowry syndrome (CLS) [MIM:303600]; an X-linked dominant disorder characterized by severe mental retardation with facial and digital dysmorphisms, and progressive skeletal deformations.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 2 protein kinase domains.
  • Post-translational
    modifications

    Autophosphorylated on Ser-386, as part of the activation process.
    Ser-227 phosphorylation promotes Ser-386 phosphorylation and leads to basal activation. Full activation by growth factors requires additional phosphorylation on Ser-369.
  • Information by UniProt

Images

  • Analysis of the purity of ab204167 by densitometry.

  • Kinase assay demonstrating specific activity of ab204167.

References

ab204167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up