Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHV KAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKAT LKVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLF TRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGH IKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGV LMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRN PANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFY FDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPL HSVVQQLHGKNLVFSDGYVVKETIGVGSYSECKRCVHKATNMEYAVKVID KSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTELMRGGELLDK ILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSNILYVDESGNP ECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSL GILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKD LVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAA TYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
    • Amino acids
      1 to 735
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 90 kDa ribosomal protein S6 kinase 1
    • dJ590P13.1
    • dJ590P13.1 (ribosomal protein S6 kinase, 90kD, polypeptide 1
    • EC 2.7.11.1
    • HU 1
    • HU1
    • KS6A1_HUMAN
    • MAP kinase activated protein kinase 1a
    • MAP kinase-activated protein kinase 1a
    • MAPK-activated protein kinase 1a
    • MAPKAP kinase 1a
    • MAPKAPK-1a
    • MAPKAPK1A
    • MGC79981
    • Mitogen-activated protein kinase-activated protein kinase 1A
    • OTTHUMP00000004113
    • p90 RSK1
    • p90-RSK 1
    • p90rsk
    • p90RSK1
    • p90S6K
    • pp90RSK1
    • Ribosomal protein S6 kinase 90kD 1
    • Ribosomal protein S6 kinase 90kD polypeptide 1
    • Ribosomal protein S6 kinase 90kDa polypeptide 1
    • Ribosomal protein S6 kinase alpha 1
    • Ribosomal protein S6 kinase alpha-1
    • Ribosomal protein S6 kinase polypeptide 1
    • Ribosomal S6 kinase 1
    • RPS6K1 alpha
    • rps6ka
    • Rps6ka1
    • RSK
    • RSK 1
    • RSK 1 p90
    • RSK-1
    • RSK1
    • S6K alpha 1
    • S6K-alpha-1
    see all
  • Function
    Serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 2 protein kinase domains.
  • Post-translational
    modifications
    Autophosphorylated on Ser-380, as part of the activation process.
  • Information by UniProt

Images

  • ab159427 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159427 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159427.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up