Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAFSELLDLVGGLGRFQVLQTMALMVSIMWLCTQSMLENFSAAVPSHRCW APLLDNSTAQASILGSLSPEALLAISIPPGPNQRPHQCRRFRQPQWQLLD PNATATSWSEADTEPCVDGWVYDRSIFTSTIVAKWNLVCDSHALKPMAQS IYLAGILVGAAACGPASDRFGRRLVLTWSYLQMAVMGTAAAFAPAFPVYC LFRFLLAFAVAGVMMNTGTLLMEWTAARARPLVMTLNSLGFSFGHGLTAA VAYGVRDWTLLQLVVSVPFFLCFLYSWWLAESARWLLTTGRLDWGLQELW RVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRT CISTLCWFAFGFTFFGLALDLQALGSNIFLLQMFIGVVDIPAKMGALLLL SHLGRRPTLAASLLLAGLCILANTLVPHEMGALRSALAVLGLGGVGAAFT CITIYSSELFPTVLRMTAVGLGQMAARGGAILGPLVRLLGVHGPWLPLLV YGTVPVLSGLAALLLPETQSLPLPDTIQDVQNQAVKKATHGTLGNSVLKS TQF
    • Amino acids
      1 to 553
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165092 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Organic anion transporter 4-like protein
    • Renal-specific transporter
    • RST
    • S22AC_HUMAN
    • Slc22a12
    • Solute carrier family 22 member 12
    • Urate anion exchanger 1
    see all
  • Function
    Required for efficient urate re-absorption in the kidney. Regulates blood urate levels. Mediates saturable urate uptake by facilitating the exchange of urate against organic anions.
  • Tissue specificity
    Detected in kidney (at protein level). Detected in fetal and adult kidney. Detected in epithelial cells of proximal tubules in renal cortex.
  • Involvement in disease
    Defects in SLC22A12 are a cause of renal hypouricemia (RH) [MIM:220150]. Patients have low serum urate levels, due to defects in renal urate re-absorption and high urinary urate excretion. Patients often appear asymptomatic, but may be subject to exercise-induced acute renal failure (ARF), chronic renal dysfunction and uric acid urolithiasis.
  • Sequence similarities
    Belongs to the major facilitator superfamily. Organic cation transporter family.
  • Cellular localization
    Cell membrane. Detected in the luminal membrane of the epithelium of renal proximal tubules.
  • Information by UniProt

Images

  • ab165092 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165092 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165092.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up