Overview

  • Product name

    Recombinant Human RSUME protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAEPVQEELSVLAAIFCRPHEWEVLSRSETDGTVFRIHTKAEGFMDADIP LELVFHLPVNYPSCLPGISINSEQLTRAQCVTVKEKLLEQAESLLSEPMV HELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLWITLLHLDHMR AKTKYVKIVEKWASDLRLTGRLMFMGKIILILLQGDRNNLKVPKS
    • Molecular weight

      49 kDa including tags
    • Amino acids

      1 to 195

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.

    Previously labelled as RWDD3. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp566K023
    • RSUME
    • RWD containing sumoylation enhancer
    • RWD domain containing 3
    • RWD domain containing protein
    • RWD domain containing protein 3
    • RWD domain-containing protein 3
    • RWD-containing sumoylation enhancer
    • rwdd3
    • RWDD3_HUMAN
    see all
  • Function

    Enhances the sumoylation of a number of proteins including HIF1A, PIAS and I-kappa-B, through direct interaction with UBC9. Has no effect on ubiquitination.
  • Tissue specificity

    Expressed in a wide number of tissues with highest expression in cerebellum, pituitary, heart, kidney, liver, stomach, pancreas, prostate and spleen. Low levels in thalamus, spinal cord, esophagus, thymus, lung and peripheral blood leukocytes.
  • Sequence similarities

    Contains 1 RWD domain.
  • Domain

    The RWD domain is required for the sumoylation enhancement activity.
  • Cellular localization

    Nucleus. Cytoplasm. Colocalizes with UBC9/UBE2I in nuclear spots.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132896 stained with Coomassie Blue.

References

ab132896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up