Description

  • Product name

    Recombinant Human RTCD1 protein
  • Purity

    > 85 % SDS-PAGE.
    ab181893 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAGPRVEVDGSIMEGGGQILRVSTALS CLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEI TFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELHLKGGTNA EMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQ LNPINLTERGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIRKEIRDLYV NIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEA AEMLLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHF AEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIGMTNPNL
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      1 to 366
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_003720

Specifications

Our Abpromise guarantee covers the use of ab181893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 0.02% DTT, 20% Glycerol

General Info

  • Alternative names

    • 2310009A18Rik
    • AI450277
    • EC 6.5.1.4
    • MGC102342
    • MGC94866
    • RNA 3' terminal phosphate cyclase
    • RNA 3-prime-terminal phosphate cyclase
    • RNA cyclase
    • RNA terminal phosphate cyclase domain 1
    • RNA terminal phosphate cyclase domain containing protein 1
    • RNA-3'-phosphate cyclase
    • RPC
    • RPC1
    • RTC domain containing protein 1
    • RTC1
    • RTCA
    • RTCD1
    see all
  • Relevance

    RTCD1 catalyzes the conversion of 3'-phosphate to a 2',3'-cyclic phosphodiester at the end of RNA. The mechanism of action of the enzyme occurs in 3 steps: (A) adenylation of the enzyme by ATP; (B) the enzyme acts on RNA-N3'P to produce RNA-N3'PP5'A; (C) a non catalytic nucleophilic attack by the adjacent 2'hydroxyl on the phosphorus in the diester linkage to produce the cyclic end product. The biological role of this enzyme is unknown but it is likely to function in some aspects of cellular RNA processing. There are two named isoforms.
  • Cellular localization

    Nucleus, nucleoplasm.

Images

  • 15% SDS-PAGE analysis of 3µg ab181893.

References

ab181893 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up