Recombinant Human RUNX1 / AML1 protein (ab134873)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant Human RUNX1 / AML1 protein
See all RUNX1 / AML1 proteins and peptides -
Purity
> 90 % SDS-PAGE.
ab134873 was expressed in E. coli as inclusion bodies, refolded using unique temperature shift inclusion body refolding technology, chromatographically purified and sterile-filtered. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
29aa_Tag_RIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAG KLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVV ALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGR GKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSL SFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQE EDTAPWRCLEESGGGGSPGRRRRRRRRRRR -
Predicted molecular weight
33 kDa including tags -
Amino acids
2 to 250
-
Specifications
Our Abpromise guarantee covers the use of ab134873 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20ºC.
pH: 8.00
Constituent: 0.32% Tris HCl
Contains NaCl,EDTA,KCl,arginine,DTT and Glycerol
General Info
-
Alternative names
- Acute myeloid leukemia 1
- Acute myeloid leukemia 1 protein
- alpha subunit core binding factor
see all -
Function
CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. The alpha subunit binds DNA and appears to have a role in the development of normal hematopoiesis. Isoform AML-1L interferes with the transactivation activity of RUNX1. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the mouse BLK promoter. Inhibits MYST4-dependent transcriptional activation. -
Tissue specificity
Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood. -
Involvement in disease
Note=A chromosomal aberration involving RUNX1/AML1 is a cause of M2 type acute myeloid leukemia (AML-M2). Translocation t(8;21)(q22;q22) with RUNX1T1.
Note=A chromosomal aberration involving RUNX1/AML1 is a cause of therapy-related myelodysplastic syndrome (T-MDS). Translocation t(3;21)(q26;q22) with EAP or MECOM.
Note=A chromosomal aberration involving RUNX1/AML1 is a cause of chronic myelogenous leukemia (CML). Translocation t(3;21)(q26;q22) with EAP or MECOM.
Note=A chromosomal aberration involving RUNX1/AML1 is found in childhood acute lymphoblastic leukemia (ALL). Translocation t(12;21)(p13;q22) with TEL. The translocation fuses the 3'-end of TEL to the alternate 5'-exon of AML-1H.
Note=A chromosomal aberration involving RUNX1 is found in acute leukemia. Translocation t(11,21)(q13;q22) that forms a MACROD1-RUNX1 fusion protein.
Defects in RUNX1 are the cause of familial platelet disorder with associated myeloid malignancy (FPDMM) [MIM:601399]. FPDMM is an autosomal dominant disease characterized by qualitative and quantitative platelet defects, and propensity to develop acute myelogenous leukemia.
Note=A chromosomal aberration involving RUNX1/AML1 is found in therapy-related myeloid malignancies. Translocation t(16;21)(q24;q22) that forms a RUNX1-CBFA2T3 fusion protein.
Note=A chromosomal aberration involving RUNX1/AML1 is a cause of chronic myelomonocytic leukemia. Inversion inv(21)(q21;q22) with USP16. -
Sequence similarities
Contains 1 Runt domain. -
Domain
A proline/serine/threonine rich region at the C-terminus is necessary for transcriptional activation of target genes. -
Post-translational
modificationsPhosphorylated in its C-terminus upon IL-6 treatment. Phosphorylation enhances interaction with MYST3.
Methylated. -
Cellular localization
Nucleus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab134873 has not yet been referenced specifically in any publications.