Overview

  • Product name

    Recombinant Human RUNX1T1/ETO/CDR protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTAL NGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFG NDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKA NLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVN ENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPN GLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQ EEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADRE ELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPA SGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKME RTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGS FCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAAT PRSTTPGTPSTIETTPR
    • Molecular weight

      88 kDa including tags
    • Amino acids

      38 to 604

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152255 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.

     This product was previously labelled as RUNX1T1 / ETO

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Acute myelogenous leukemia 1 translocation 1 cyclin D related
    • Acute myelogenous leukemia 1 translocation 1 protein
    • AML1 MTG8
    • AML1T1
    • CBFA2T1
    • CDR
    • Core binding factor runt domain alpha subunit 2 translocated to 1
    • Core binding factor runt domain alpha subunit 2 translocated to 1 cyclin D related
    • Cyclin D related
    • Cyclin D related protein
    • Cyclin-D-related protein
    • Eight twenty one protein
    • ETO
    • ETO protein
    • MGC2796
    • MTG 8
    • MTG 8b
    • MTG8
    • MTG8 protein
    • MTG8_HUMAN
    • MTG8b
    • Myeloid translocation gene on 8q22
    • Protein CBFA2T1
    • Protein ETO
    • Protein MTG 8
    • Protein MTG8
    • Runt related transcription factor 1 translocated to 1
    • Runt related transcription factor 1 translocated to 1 (cyclin D related)
    • Runt related transcription factor 1 translocated to 1 cyclin D related
    • RUNX1 translocation partner 1
    • RUNX1T1
    • Zinc finger MYND domain containing protein 2
    • Zinc finger MYND domain-containing protein 2
    • ZMYND 2
    • ZMYND2
    see all
  • Function

    Transcription regulator that excerts its function by binding to histone deacetylases and transcription factors. Can repress transactivation mediated by TCF12.
  • Tissue specificity

    Most abundantly expressed in brain. Lower levels in lung, heart, testis and ovary.
  • Involvement in disease

    Note=A chromosomal aberration involving RUNX1T1 is a cause of acute myeloid leukemia (AML-M2). Translocation t(8;21)(q22;q22) with RUNX1/AML1.
    Defects in RUNX1T1 may be a cause of colorectal cancer (CRC) [MIM:114500].
  • Sequence similarities

    Belongs to the CBFA2T family.
    Contains 1 MYND-type zinc finger.
    Contains 1 TAFH (NHR1) domain.
  • Domain

    The TAFH domain mediates interaction with transcription regulators.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152255 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152255.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up