Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSD TNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMV LLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMR MNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMN SQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAK EEVIGMVTRAHKDTFMYNQEQQENSAESMQPKRGERIRKNMEQYNLNHDH CGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAY TQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHE IWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRF ASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSD EEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASI FTKLLLKLPDLRSLNNMHSEELLAFKVHP
    • Amino acids
      1 to 579
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as NR1D2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BD73
    • EAR 1R
    • EAR-1R
    • HZF2
    • Nr1d2
    • NR1D2_HUMAN
    • Nuclear receptor Rev ErbA beta variant 1
    • Nuclear receptor Rev ErbA beta variant 2
    • Nuclear receptor subfamily 1 group D member 2
    • Orphan nuclear hormone receptor BD73
    • Rev erb beta
    • Rev erba alpha related receptor
    • Rev-erb-beta
    • REVB
    • REVERBB
    • RVR
    • V-erbA-related protein 1-related
    see all
  • Function
    Binds to the sequences 5'-AATGTAGGTCA-3' and 5'-ATAACTAGGTCA-3'. Acts as a potent competitive repressor of ROR alpha function.
  • Sequence similarities
    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153033 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153033 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153033.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up