Description

  • Product name

    Recombinant Human RWDD4A protein
  • Purity

    > 90 % SDS-PAGE.
    ab181915 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSANEDQEMELEALRSIYEGDESFREL SPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVK QSILAKLQEA VEANLGTAMT YTLFEYAKDN KEQFMENHNP INSATSISNI ISIETPNTAPSSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVK HLSKTGSKDDE
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      1 to 188
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_689895.

Specifications

Our Abpromise guarantee covers the use of ab181915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • FAM28A
    • Family with sequence similarity 28, member A
    • RWD domain containing 4
    • RWD domain containing 4A
    • RWD domain containing protein 4A
    • RWD domain-containing protein 4
    • RWDD4
    • RWDD4_HUMAN
    • RWDD4A
    see all
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab181915 (3µg).

References

ab181915 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up