Description

  • Product name

    Recombinant Human S100 alpha protein
    See all S100 alpha proteins and peptides
  • Purity

    > 95 % Densitometry.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKHHHHHHASGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTE LSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFW ENS
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      2 to 94
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab206460 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.29% Sodium chloride, 0.24% Tris

    Lyophilized from a 0.4 µm filtered solution.

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

General Info

  • Alternative names

    • Bpb
    • NEF
    • Protein S100-A1
    • S-100 protein alpha chain
    • S-100 protein subunit alpha
    • S100
    • S100 alpha
    • S100 Alpha Chain
    • S100 Beta Chain
    • S100 Calcium Binding Protein A1
    • S100 Calcium Binding Protein B
    • S100 Calcium Binding Protein Beta Neural
    • S100 calcium-binding protein A1
    • S100 protein alpha polypeptide
    • S100A
    • s100a1
    • S10A1_HUMAN
    see all
  • Function

    Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites.
  • Tissue specificity

    Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 14% SDS-PAGE analysis of ab206460.
    Lane 1: Reduced and heated sample, 5μg / lane
    Lane 2: Non-reduced and non-heated sample, 5μg / lane

References

ab206460 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206460.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up