Description

  • Product name

    Recombinant human S100 beta protein
    See all S100 beta proteins and peptides
  • Biological activity

    Measured by its ability to bind human AGER in a functional ELISA.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKE QEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      1 to 92
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_006263 Includes a polyhistidine tag at the N-terminus, and has a calculated MW of 11.5 kDa. The predicted N-terminus is Met. DTT-reduced Protein migrates as 11 kDa in SDS-PAGE .

Specifications

Our Abpromise guarantee covers the use of ab200489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.61% Tris buffer, 0.87% Sodium chloride, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • NEF
    • Protein S100 B
    • Protein S100-B
    • S 100 calcium binding protein beta chain
    • S 100 protein beta chain
    • S-100 protein beta chain
    • S-100 protein subunit beta
    • S100
    • S100 calcium binding protein beta (neural)
    • S100 calcium-binding protein B
    • S100 protein beta chain
    • S100B
    • S100B_HUMAN
    • S100beta
    see all
  • Function

    Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling.
  • Tissue specificity

    Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.
  • Sequence similarities

    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • DTT reduced SDS-PAGE analysis of ab200489 with staining overnight with Coomassie Blue.

    DTT-reduced protein migrates as 11 kDa in SDS-PAGE .

References

ab200489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up