Recombinant Human S100 Calcium Binding Protein A13/S100A13 (ab105573)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Human S100 Calcium Binding Protein A13/S100A13 -
Purity
> 95 % SDS-PAGE.
ab105573 was purified using conventional chromatography. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMAAEPLTELEESIETVVTTFFTFARQEGRK DSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLI GELAKEIRKKKDLKIRKK -
Predicted molecular weight
14 kDa including tags -
Amino acids
1 to 98 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab105573 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Additional notes
This product was previously labelled as S100 Calcium Binding Protein A13
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.29% Sodium chloride
General Info
-
Alternative names
- Protein S100 A13
- Protein S100-A13
- S100 calcium binding protein A13
see all -
Function
Plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. Binds two calcium ions per subunit. Binds one copper ion. Binding of one copper ion does not interfere with calcium binding. Required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine. -
Tissue specificity
Expressed in heart and skeletal muscle. -
Sequence similarities
Belongs to the S-100 family.
Contains 2 EF-hand domains. -
Cellular localization
Cytoplasm. Secreted. Secretion is mediated by exposure to stress and requires copper ions. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab105573 has not yet been referenced specifically in any publications.