Recombinant Human S100 Calcium Binding Protein A13/S100A13 (ab221318)

Description

  • Product name

    Recombinant Human S100 Calcium Binding Protein A13/S100A13
    See all S100 Calcium Binding Protein A13/S100A13 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLL KDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
    • Predicted molecular weight

      12 kDa
    • Amino acids

      1 to 98
    • Additional sequence information

      AAH00632.

Specifications

Our Abpromise guarantee covers the use of ab221318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as S100 Calcium Binding Protein A13

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.61% Tris, 0.87% Sodium chloride, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Protein S100 A13
    • Protein S100-A13
    • S100 calcium binding protein A13
    • S100 calcium-binding protein A13
    • S100a13
    • S10AD_HUMAN
    see all
  • Function

    Plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. Binds two calcium ions per subunit. Binds one copper ion. Binding of one copper ion does not interfere with calcium binding. Required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine.
  • Tissue specificity

    Expressed in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Cytoplasm. Secreted. Secretion is mediated by exposure to stress and requires copper ions.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab221318 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 13 kDa in SDS-PAGE.

References

ab221318 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221318.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up