Description

  • Product name

    Recombinant Human S100A10 protein (His tag)
    See all S100A10 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/g
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPL AVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      1 to 97
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab221399 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 5% Trehalose, 0.61% Tris buffer, 0.87% Sodium chloride

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • 42C
    • AA409961
    • AL024248
    • Annexin II ligand
    • Annexin II ligand, calpactin I, light polypeptide
    • Annexin II tetramer (AIIt) p11 subunit
    • Annexin II, light chain
    • ANX2L
    • ANX2LG
    • Ca[1]
    • CAL12
    • CAL1L
    • Calpactin I light chain
    • Calpactin I, p11 subunit
    • Calpactin-1 light chain
    • Cellular ligand of annexin II
    • CLP11
    • GP11
    • MGC111133
    • Nerve growth factor-induced protein 42C
    • OTTHUMP00000015269
    • OTTHUMP00000015270
    • p10
    • p10 protein
    • p11
    • Protein S100 A10
    • Protein S100-A10
    • S100 calcium binding protein A10
    • S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11))
    • S100 calcium binding protein A10 (calpactin)
    • S100 calcium-binding protein A10
    • S100a10
    • S10AA_HUMAN
    see all
  • Function

    Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.
  • Sequence similarities

    Belongs to the S-100 family.
  • Information by UniProt

Images

  • SDS-PAGE using ab221399. DTT-reduced protein migrates as 12 kDa.

References

ab221399 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221399.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up