Description

  • Product name

    Recombinant Human S100A12/CGRP protein
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKHHHHHHAS TKLEEHLEGI VNIFHQYSVR KGHFDTLSKG ELKQLLTKEL ANTIKNIKDK AVIDEIFQGL DANQDEQVDF QEFISLVAIA LKAAHYHTHK E
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      2 to 92
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as S100A12

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.242% Tris, 0.29% Sodium chloride

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter the product by an appropriate sterile filter before using it in the cell culture.

General Info

  • Alternative names

    • CAAF1
    • CAGC
    • Calcitermin
    • Calcium-binding protein in amniotic fluid 1
    • Calgranulin C
    • Calgranulin-C
    • Calgranulin-related protein
    • CGRP
    • EN RAGE
    • EN-RAGE
    • ENRAGE
    • Extracellular newly identified RAGE-binding protein
    • migration inhibitory factor-related protein 6
    • MRP6
    • Neutrophil S100 protein
    • p6
    • Protein S100 A12
    • S100 calcium binding protein A12
    • S100 calcium-binding protein A12
    • S100 calcium-binding protein A12 (calgranulin C)
    • S100A12
    • S10AC_HUMAN
    see all
  • Function

    Calcitermin possesses antifungal activity against C.albicans and is also active against E.coli and P.aeruginosa but not L.monocytogenes and S.aureus. Binds calcium, zinc and copper. Presence of zinc increases the affinity for calcium. Plays an important role in the inflammatory response. Interaction with AGER on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators.
  • Tissue specificity

    Monocytes and lymphocytes.
  • Sequence similarities

    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Information by UniProt

Images

  • 14% SDS-PAGE analysis of 5 μg ab103393
    Lane 1: reduced and heated sample
    Lane 2: non reduced and non heated sample

References

This product has been referenced in:

  • Lorenzi R  et al. Soluble form of receptor for advanced glycation end-products (sRAGE): do sRAGE ligands or anti-sRAGE auto-antibodies interfere with sRAGE quantification? Ann Clin Biochem N/A:N/A (2013). Read more (PubMed: 23982266) »
See 1 Publication for this product

Customer reviews and Q&As

Answer

Thank you for your reply and for kindly confirming these details. No problem, I wanted to ensure I had the correct information so I could provide an accurate answer for you. I can confirm the following details regarding these products: ab103393 S100A12 protein: Recombinant full length Human S100A12 (amino acids 2-92) ab37657: The antibody is likely to detect ab103393 S100A12 protein, since the protein seuqence almost completely overlaps with the human S100A12 immunogen sequence for this antibody: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE ab50250 is a monoclonal raised against the whole length protein. I am sorry the epitope for this has not been mapped. However as it has been rasied against whole protein, I would suggest it should detect the full length recombinant protein. I would recommend also to consider that the protein ab103393 has a his tag. There is a small possibility the tag may interfere with antibody binding, and I am sorry we have no data to guarantee that the his tag will not prevent the binding of ab37657 or ab50250. I am sorry we have no other S100A12 proteins without his tag for you to try on this occasion. I hope this information will be helpful to you. Should you have any further questions, please do not hesitate to contact us.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up