Description

  • Product name

    Recombinant Human S100A14 protein
    See all S100A14 proteins and peptides
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKHHHHHHASMGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKET LTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGE AAKSVKLERPVRGH
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      1 to 104
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Store lyophilized protein at –20°C. Lyophilized protein remains stable until the expiry date when stored at –20°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after one week at 4°C.

     This product was previously labelled as S100 calcium binding protein A14

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.242% Tris, 0.29% Sodium chloride

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in cell culture.

General Info

  • Alternative names

    • BCMP84
    • Protein S100-A14
    • S100 calcium binding protein A14
    • S100 calcium-binding protein A14
    • S100a14
    • S100A15
    • S10AE_HUMAN
    • S114
    see all
  • Function

    Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium.
  • Tissue specificity

    Expressed at highest levels in colon and at moderate levels in thymus, kidney, liver, small intestine, and lung. Low expression in heart and no expression is seen in brain, skeletal muscle, spleen, placenta and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 1 EF-hand domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 14% SDS-PAGE analysis of ab101041
    Lane 1: Molecular weight markers; 14, 21, 31, 45, 66, 97 kDa
    Lane 2: ab101041 (reduced and heated, 5μg / lane)
    Lane 3: ab101041 (non-reduced and non-heated, 5μg / lane).

References

ab101041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101041.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up