Description

  • Product name

    Recombinant Human S100A14 protein (His tag)
    See all S100A14 proteins and peptides
  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLV TQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERP VRGH
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      1 to 104
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab221403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as S100 calcium binding protein A14

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 5% Trehalose, 0.61% Tris buffer, 0.87% Sodium chloride

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • BCMP84
    • Protein S100-A14
    • S100 calcium binding protein A14
    • S100 calcium-binding protein A14
    • S100a14
    • S100A15
    • S10AE_HUMAN
    • S114
    see all
  • Function

    Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium.
  • Tissue specificity

    Expressed at highest levels in colon and at moderate levels in thymus, kidney, liver, small intestine, and lung. Low expression in heart and no expression is seen in brain, skeletal muscle, spleen, placenta and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 1 EF-hand domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE using ab221403. DTT-reduced protein migrates as 13 kDa.

References

ab221403 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up