Description

  • Product name

    Recombinant Human S100P protein
    See all S100P proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKD KDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
    • Predicted molecular weight

      10 kDa
    • Amino acids

      1 to 95
    • Additional sequence information

      (Accession # AAH06819).

Specifications

Our Abpromise guarantee covers the use of ab221020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.61% Tris, 0.87% Sodium chloride, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • MIG9
    • Migration inducing gene 9
    • Protein S100-E
    • Protein S100-P
    • Protein S100P
    • S100 calcium binding protein P
    • S100 calcium-binding protein P
    • S100 P
    • S100E
    • S100P
    • S100P_HUMAN
    see all
  • Tissue specificity

    Up-regulated in various pancreatic ductal adenocarcinomas and pancreatic intraepithelial neoplasias.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Nucleus. Cytoplasm. Colocalizes with S100PBP in the nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab221020 stained overnight with Coomassie Blue.  The protein migrates as 10.4 kDa.

References

ab221020 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up