Description

  • Product name

    Recombinant Human S31 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTT KKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLS VDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTIS IFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILI LYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTS DPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNED FKLAFKKLIRCREHT
    • Amino acids

      1 to 365
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as 5HT1E Receptor. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 5 HT1E
    • 5 hydroxytryptamine (serotonin) receptor 1E
    • 5 hydroxytryptamine (serotonin) receptor 1E G protein coupled
    • 5 hydroxytryptamine 1E receptor
    • 5-HT-1E
    • 5-hydroxytryptamine receptor 1E
    • 5HT1E Receptor
    • HTR1E
    • S31
    • Serotonin receptor 1E
    see all
  • Relevance

    This is one of the several different receptors for 5-HT, a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. The 5-HT1E receptor is expressed in human cortex, caudate, putamen, and amygdala, as well as in dorsal root ganglia and in coronary artery. ESTs have been isolated from human brain cancer libraries.
  • Cellular localization

    Cell Membrane, Multi-pass membrane protein.

Images

  • ab158713 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up