Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTE FEKFHASIRIPPFDNDLDHPG
    • Amino acids
      206 to 276
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158714 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as 5HT1E Receptor. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5 HT1E
    • 5 hydroxytryptamine (serotonin) receptor 1E
    • 5 hydroxytryptamine (serotonin) receptor 1E G protein coupled
    • 5 hydroxytryptamine 1E receptor
    • 5-HT-1E
    • 5-hydroxytryptamine receptor 1E
    • 5HT1E Receptor
    • HTR1E
    • S31
    • Serotonin receptor 1E
    see all
  • Relevance
    This is one of the several different receptors for 5-HT, a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. The 5-HT1E receptor is expressed in human cortex, caudate, putamen, and amygdala, as well as in dorsal root ganglia and in coronary artery. ESTs have been isolated from human brain cancer libraries.
  • Cellular localization
    Cell Membrane, Multi-pass membrane protein.

Images

  • ab158714 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158714 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158714.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up